PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10012920m
Common NameCICLE_v10012920mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 175aa    MW: 18983 Da    PI: 5.826
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10012920mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB187.11.3e-5825122198
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+e
  Ciclev10012920m  25 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREME 118
                      69******************************************************************************************** PP

            NF-YB  95 gekk 98 
                      g++k
  Ciclev10012920m 119 GDTK 122
                      *975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-5620141IPR009072Histone-fold
SuperFamilySSF471133.61E-4128133IPR009072Histone-fold
PfamPF008083.4E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-205977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-207896No hitNo description
PRINTSPR006151.5E-2097115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MAAEAPASPG GGSHESGEQS PRSNVREQDR YLPIANISRI MKKALPANGK IAKDAKETVQ  60
ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF EDYIDPLKIY LTRYREMEGD  120
TKGNAKGGDA SAKKDGQPNP NTQLAHQGSF PQGVNYGNSQ GSIYNYQLGD FSSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428884.11e-128hypothetical protein CICLE_v10012920mg
RefseqXP_006480594.11e-128PREDICTED: nuclear transcription factor Y subunit B-10 isoform X1
RefseqXP_006480595.11e-128PREDICTED: nuclear transcription factor Y subunit B-10 isoform X1
SwissprotQ8VYK43e-86NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLV4URI01e-128V4URI0_9R
STRINGGLYMA03G33490.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.13e-86nuclear factor Y, subunit B10